Never miss a sale! Sign up for our texts HERE

styling gel

(19 Items)
  • 154582 499007 499007 1 Hard Up Hard Holding Gel 5.1 Fl. Oz. Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz. True sexyhair/sexyhairstylehardupgel5.1oz.jpg Bonus Deal Available 10.98 10.98 6.99 True False False False 6.99 False False Diversion contract is required 0 Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a maximum high hold finish and humidity resistance that lasts up to 48 hours. True Log in to view pricing! False
    Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz.

    Hard Up Hard Holding Gel

    Bonus Offer
    View Sizes
  • 109085 183275 183275 1 JoiGel Firm 8.5 Fl. Oz. Joico Joico JoiGel Firm 8.5 Fl. Oz. False joico/joicojoigelfirm.jpg Bonus Deal Available 11.95 11.95 10.00 True False False False 10.00 False False Diversion contract is required 0 Joico JoiGel Firm is a firm-hold formula –which locks in shine and hydration and locks OUT pollution and humidity –coaxes those spirited strands into shape. True Log in to view pricing! False
    Joico JoiGel Firm 8.5 Fl. Oz.

    Joico
    JoiGel Firm

    8.5 Fl. Oz.

    SKU 183275

    Bonus Offer
    Quick View
  • 154595 499010 499010 1 Blow Dry Volumizing Gel 8.5 Fl. Oz. Sexy Hair Blow Dry Volumizing Gel 8.5 Fl. Oz. False sexyhair/sexyhairbigblowdryvolumizing8.5oz.jpg Bonus Deal Available 10.98 10.98 10.98 False False False False 0.00 False False Diversion contract is required 0 Sexy Hair Big Sexy Blow Dry Volumizing Gel creates volume and lift with a workable, medium hold and style memory that lasts up to 48 hours. True Log in to view pricing! False
    Sexy Hair Blow Dry Volumizing Gel 8.5 Fl. Oz.

    Blow Dry Volumizing Gel

    8.5 Fl. Oz.

    SKU 499010

    Bonus Offer
    Quick View
  • 565 988334 988334 1 Hydro Gel Light 5.1 Fl. Oz. Framesi BY framesiā„¢ Hydro Gel Light 5.1 Fl. Oz. False framesi/738884262312.jpg Bonus Deal Available 8.85 8.85 8.85 False False False False 0.00 False False Diversion contract is required 0 A styling and sculpting gel that creates natural, flexible hold while adding volume and shine. Will not build up and lets your color shine through. True Log in to view pricing! False
    Framesi Hydro Gel Light 5.1 Fl. Oz.

    BY framesiā„¢ Hydro Gel Light

    5.1 Fl. Oz.

    SKU 988334

    Bonus Offer
    Quick View
  • 566 988335 988335 1 Hydro Gel Strong 5.1 Fl. Oz. Framesi BY framesiā„¢ Hydro Gel Strong 5.1 Fl. Oz. False framesi/738884262329.jpg Bonus Deal Available 8.85 8.85 8.85 False False False False 0.00 False False Diversion contract is required 0 A strong hold gel that fortifies hair, leaving no residue. Volumizes and enhances shine, lets your color shine through. True Log in to view pricing! False
    Framesi Hydro Gel Strong 5.1 Fl. Oz.

    BY framesiā„¢ Hydro Gel Strong

    5.1 Fl. Oz.

    SKU 988335

    Bonus Offer
    Quick View
  • 122877 491475 491475 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz.

    DevaCurl
    Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

    12 Fl. Oz.

    SKU 491475

    Bonus Offer
    Quick View
  • 109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler

    Bonus Offer
    View Sizes
  • 109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False
    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    ULTRA DEFINING GEL Strong Hold No-Crunch Styler

    Bonus Offer
    View Sizes
  • 166030 889091 889091 1 Firm Hold Gel 4.2 Fl. Oz. eufora eufora FOR HIM Firm Hold Gel 4.2 Fl. Oz. False eufora/euforaforhimfirmholdgel4oz.jpg Bonus Deal Available 10.50 10.50 10.50 False False False False 0.00 False False Diversion contract is required 0 eufora FOR HIM Firm Hold Gel is a strong hold styling gel for delivering maximum hold and shine. True Log in to view pricing! False
    eufora Firm Hold Gel 4.2 Fl. Oz.

    eufora
    FOR HIM Firm Hold Gel

    4.2 Fl. Oz.

    SKU 889091

    Bonus Offer
    Quick View
  • 4566 841005 841005 1 Rosemary Repel Styling Gel 8 Fl. Oz. Fairy Tales Hair Care Fairy Tales Hair Care Rosemary Repel Styling Gel 8 Fl. Oz. False fairytaleshaircare/fairy-tales-rosemary-repel-styling-gel_web.jpg Bonus Deal Available 8.89 8.89 8.89 False False False False 0.00 False False Diversion contract is required 0 Rosemary RepelĀ® Styling Gel is perfect for smoothing hair back, spiking it up, and keeping the bugs away! Clinically proven to help prevent head lice with organic herbs and natural plant extracts. The Rosemary RepelĀ® Lice Prevention line is #1 recommended by pediatricians, school nurses, and moms since 1999! True Log in to view pricing! False
    Fairy Tales Hair Care Rosemary Repel Styling Gel 8 Fl. Oz.

    Fairy Tales Hair Care
    Rosemary Repel Styling Gel

    8 Fl. Oz.

    SKU 841005

    Bonus Offer
    Quick View
  • 165955 622001 622001 1 MODE Styling Gel 6.7 Fl. Oz. JOHNNY B. JOHNNY B. MODE Styling Gel 6.7 Fl. Oz. True johnnyb/jbmodestylinggel6oz.jpg Bonus Deal Available 6.50 6.50 6.50 False False False False 0.00 False False Diversion contract is required 0 JOHNNY B. MODE Styling Gel is a high-shine gel that is great for creating wet looks or styles that require a strong hold. True Log in to view pricing! False
    JOHNNY B. MODE Styling Gel 6.7 Fl. Oz.

    JOHNNY B.
    MODE Styling Gel

    Bonus Offer
    View Sizes
  • 137669 420155 420155 1 AllCurl Defining Jelly 3 Fl. Oz. Kenra Professional Kenra Professional AllCurl Defining Jelly 3 Fl. Oz. False kenraprofessional/kenraprofessionalallcurldefiningjelly3oz.jpg Bonus Deal Available 10.53 10.53 10.53 False False False False 0.00 False False Diversion contract is required 0 Kenra Professional AllCurl Defining Jelly is a light hold no-crunch gel that enhances curls with frizz control, enhances shine, and manageability. True Log in to view pricing! False
    Kenra Professional AllCurl Defining Jelly 3 Fl. Oz.

    Kenra Professional
    AllCurl Defining Jelly

    3 Fl. Oz.

    SKU 420155

    Bonus Offer
    Quick View
  • 121131 420055 420055 1 Styling Gel 17 6 Fl. Oz. Kenra Professional Kenra Professional Styling Gel 17 6 Fl. Oz. False kenraprofessional/2419764KenraProfessionalStylingGel6floz.jpg Bonus Deal Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required 0 Kenra Professional Styling Gel 17 designed to create versatile looks. True Log in to view pricing! False
    Kenra Professional Styling Gel 17 6 Fl. Oz.

    Kenra Professional
    Styling Gel 17

    6 Fl. Oz.

    SKU 420055

    Bonus Offer
    Quick View
  • 58778 485858 485858 1 Classic Gel 5.1 Fl. Oz. Keune Keune 1922 by J.M. Keune Classic Gel 5.1 Fl. Oz. False keune/keune1922gel.png Bonus Deal Available 13.25 13.25 13.25 False False False False 0.00 False False Diversion contract is required 0 Keune 1922 by J.M. Keune Classic Styling Gel with extra strong hold and shine. Locks any style in place. Contains Creatine and Hemp. True Log in to view pricing! False
    Keune Classic Gel 5.1 Fl. Oz.

    Keune
    1922 by J.M. Keune Classic Gel

    5.1 Fl. Oz.

    SKU 485858

    Bonus Offer
    Quick View
  • 162730 486069 486069 1 HEAD LOCK 6.8 Fl. Oz. Keune Keune Style HEAD LOCK 6.8 Fl. Oz. False keune/keuneheadlock6.8oz.jpg Bonus Deal Available 13.25 13.25 13.25 False False False False 0.00 False False Diversion contract is required 0 Keune's HEAD LOCK is a timeless classic in the range. First conceptualized and meticulously crafted in 1977, this gel has stood the test of time and is all about structure, shine — and amazing hold. True Log in to view pricing! False
    Keune HEAD LOCK 6.8 Fl. Oz.

    Keune
    Style HEAD LOCK

    6.8 Fl. Oz.

    SKU 486069

    Bonus Offer
    Quick View
(19 Items)