styling gel

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

154582 499007 499007 1 Hard Up Hard Holding Gel 5.1 Fl. Oz. Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz. True sexyhair/sexyhairstylehardupgel5.1oz.jpg Bonus Deal Available 10.98 10.98 8.78 True False False False 8.78 False False Diversion contract is required 0 Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a maximum high hold finish and humidity resistance that lasts up to 48 hours. True Log in to view pricing! False

Hard Up Hard Holding Gel

On SaleLog in to view pricing!

View Sizes

162727 486060 486060 1 SPRING LOADED 6.8 Fl. Oz. Keune Keune Style SPRING LOADED 6.8 Fl. Oz. False keune/keunespringloaded5.1oz.jpg Bonus Deal Available 13.25 13.25 11.93 True False False False 11.93 False False Diversion contract is required 0 Load, nourish, and define curls with Keune's SPRING LOADED soft gel. True Log in to view pricing! False

Keune
Style SPRING LOADED

6.8 Fl. Oz.

SKU 486060

On SaleLog in to view pricing!

Quick View

154595 499010 499010 1 Blow Dry Volumizing Gel 8.5 Fl. Oz. Sexy Hair Blow Dry Volumizing Gel 8.5 Fl. Oz. False sexyhair/sexyhairbigblowdryvolumizing8.5oz.jpg Bonus Deal Available 10.98 10.98 10.98 False False False False 0.00 False False Diversion contract is required 0 Sexy Hair Big Sexy Blow Dry Volumizing Gel creates volume and lift with a workable, medium hold and style memory that lasts up to 48 hours. True Log in to view pricing! False

Blow Dry Volumizing Gel

8.5 Fl. Oz.

SKU 499010

Log in to view pricing!

Quick View

22981 251396 251396 1 This is a Medium Hold Modeling Gel 8.45 Fl. Oz. Davines Davines More Inside This is a Medium Hold Modeling Gel 8.45 Fl. Oz. False davines/davinesmoreinsidemodelinggel845floz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False True Diversion contract is required 0 Davines More Inside This Is A Medium Hold Modeling Gel gives body an elasticity to curls, dries quickly, and eliminates frizz. True Log in to view pricing! False

Davines
More Inside This is a Medium Hold Modeling Gel

8.45 Fl. Oz.

SKU 251396

Log in to view pricing!

Quick View

20829 251395 251395 1 This is a Strong Hold Cream Gel 4.22 Fl. Oz. Davines Davines More Inside This is a Strong Hold Cream Gel 4.22 Fl. Oz. False davines/davinesmoreinsidestrongcreamgel422floz.png Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False True Diversion contract is required 0 Davines More Inside This Is A Strong Hold Cream Gel is quick-drying, residue-free and workable. True Log in to view pricing! False

Davines
More Inside This is a Strong Hold Cream Gel

4.22 Fl. Oz.

SKU 251395

Log in to view pricing!

Quick View

122877 491475 491475 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

12 Fl. Oz.

SKU 491475

Log in to view pricing!

Quick View

161307 182619 182619 1 Curls Like Us Define & Seal Curl Defining Gelée 8.5 Fl. Oz. Joico Joico Curl Care Curls Like Us Define & Seal Curl Defining Gelée 8.5 Fl. Oz. False joico/joicocurlslikeusdefineandsealgelee.jpg Bonus Deal Available 14.45 14.45 14.45 False False False False 0.00 False False Diversion contract is required 0 Keep your curls in formation with Joico Curls Like Us Define & Seal Curl Defining Gelée, the medium-hold gelée that won’t flake on you. True Log in to view pricing! False

Joico
Curl Care Curls Like Us Define & Seal Curl Defining Gelée

8.5 Fl. Oz.

SKU 182619

Log in to view pricing!

Quick View

137669 420155 420155 1 AllCurl Defining Jelly 3 Fl. Oz. Kenra Professional Kenra Professional AllCurl Defining Jelly 3 Fl. Oz. False kenraprofessional/kenraprofessionalallcurldefiningjelly3oz.jpg Bonus Deal Available 10.53 10.53 10.53 False False False False 0.00 False False Diversion contract is required 0 Kenra Professional AllCurl Defining Jelly is a light hold no-crunch gel that enhances curls with frizz control, enhances shine, and manageability. True Log in to view pricing! False

Kenra Professional
AllCurl Defining Jelly

3 Fl. Oz.

SKU 420155

Log in to view pricing!

Quick View

153149 702914 702914 1 Curl Jam Defining Gel 10.1 Fl. Oz. Schwarzkopf Professional Schwarzkopf Professional OSiS+ Curl Jam Defining Gel 10.1 Fl. Oz. False schwarzkopf/osiscurljam10.1floz.jpg Bonus Deal Available 14.45 14.45 14.45 False False False False 0.00 False False Diversion contract is required 0 Schwarzkopf OSiS+ Curl Jam Defining Gel defines natural curls and waves. True Log in to view pricing! False

Schwarzkopf Professional
OSiS+ Curl Jam Defining Gel

10.1 Fl. Oz.

SKU 702914

Log in to view pricing!

Quick View

153150 702915 702915 1 Tipsy Twirl Enhancing Jelly 10.1 Fl. Oz. Schwarzkopf Professional Schwarzkopf Professional OSiS+ Tipsy Twirl Enhancing Jelly 10.1 Fl. Oz. False schwarzkopf/osistipsytwirl10.1floz.jpg Bonus Deal Available 14.45 14.45 14.45 False False False False 0.00 False False Diversion contract is required 0 Schwarzkopf OSiS+ Tipsy Twirl Enhancing Jelly is a texture-enhancing curl jelly that defines natural waves and curls. True Log in to view pricing! False

Schwarzkopf Professional
OSiS+ Tipsy Twirl Enhancing Jelly

10.1 Fl. Oz.

SKU 702915

Log in to view pricing!

Quick View

156125 559221 559221 1 curl foaming gel 6.7 Fl. Oz. Verb Verb curl foaming gel 6.7 Fl. Oz. False verb/verbcurlfoaminggel6.7.jpg Bonus Deal Available 12.22 12.22 12.22 False False False False 0.00 False False Diversion contract is required 0 Verb curl foaming gel adds frizz control, lightweight hold, and definition without stiffness. True Log in to view pricing! False

Verb
curl foaming gel

6.7 Fl. Oz.

SKU 559221

Log in to view pricing!

Quick View

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler