travel/minis

160297 253085 253085 1 OI Travel Holiday Kit 4 pc. Davines Davines OI Travel Holiday Kit 4 pc. davines/oiminiholi24.jpg 24.75 24.75 24.75 False True Valid Thru 12/31/24 False False 0.00 False True Diversion contract is required 0 Davines OI Travel Holiday Kit includes shampoo, conditioner, treatment, and hand balm.
Includes:
1 OI Shampoo 3.04 oz.
1 OI Conditioner 2.64 oz.
1 OI All In One Milk 1.69 oz.
1 OI Hand Balm 1.01 oz. True Log in to view pricing! False

Davines
OI Travel Holiday Kit

4 pc.

SKU 253085

Promotional ItemLog in to view pricing!

Quick View

50545 298085 298085 1 fluxus touchable hairspray 1.5 Fl. Oz. amika: amika: fluxus touchable hairspray 1.5 Fl. Oz. amika/amikaholdfluxustouchablehairspray15oznoshadowhi.jpg 6.00 6.00 4.80 True False False False 4.80 False False Diversion contract is required 0 amika: fluxus touchable hairspray is a flexible working hairspray for stay-all-day style that you’ll still be able to run your fingers through. True Log in to view pricing! False

amika:
fluxus touchable hairspray

1.5 Fl. Oz.

SKU 298085

On SaleLog in to view pricing!

Quick View

20832 252147 252147 1 This is a Sea Salt Spray 3.38 Fl. Oz. Davines Davines More Inside This is a Sea Salt Spray 3.38 Fl. Oz. davines/sea-salt-spray-travel.jpg 9.00 9.00 7.20 True False False False 7.20 False True Diversion contract is required 0 Davines More Inside This Is A Sea Salt Spray is ideal for a tousled, beachy, full-bodied look with a matte finish. True Log in to view pricing! False

Davines
More Inside This is a Sea Salt Spray

3.38 Fl. Oz.

SKU 252147

On SaleLog in to view pricing!

Quick View

109733 491453 491453 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 3 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 3 Fl. Oz. devacurl/devacurlnewpackagingdevagslightdefininggel3oz.jpg 7.75 7.75 5.00 True False False False 5.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

3 Fl. Oz.

SKU 491453

On SaleLog in to view pricing!

Quick View

109530 491454 491454 1 NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 3 Fl. Oz. DevaCurl DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 3 Fl. Oz. devacurl/devagsnopoooriginal3oz.jpg 7.75 7.75 5.00 True False False False 5.00 False False Diversion contract is required 0 DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture designed for dry, medium to coarse curls. True Log in to view pricing! False

DevaCurl
NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

3 Fl. Oz.

SKU 491454

On SaleLog in to view pricing!

Quick View

109636 491455 491455 1 ONE CONDITION ORIGINAL Rich Cream Conditioner 3 Fl. Oz. DevaCurl DevaCurl ONE CONDITION ORIGINAL Rich Cream Conditioner 3 Fl. Oz. devacurl/devagsoneconditionoriginal3oz.jpg 7.75 7.75 5.00 True False False False 5.00 False False Diversion contract is required 0 DevaCurl ONE CONDITION ORIGINAL Rich Creamy Conditioner is designed for dry, medium to Coarse Curls with olive oil and nourishing botanicals. True Log in to view pricing! False

DevaCurl
ONE CONDITION ORIGINAL Rich Cream Conditioner

3 Fl. Oz.

SKU 491455

On SaleLog in to view pricing!

Quick View

160033 491499 491499 1 SUPERCREAM Rich Coconut-Infused Definer 3 Fl. Oz. DevaCurl DevaCurl SUPERCREAM Rich Coconut-Infused Definer 3 Fl. Oz. devacurl/devacurlsupercream3oz.jpg 10.00 10.00 6.00 True False False False 6.00 False False Diversion contract is required 0 DevaCurl SUPERCREAM Rich Coconut-Infused Definer is a multitasking, ultra-rich cream with a hydra-definition blend that provides coarse curls with smoothness, shape, shine, and frizz control. True Log in to view pricing! False

DevaCurl
SUPERCREAM Rich Coconut-Infused Definer

3 Fl. Oz.

SKU 491499

On SaleLog in to view pricing!

Quick View

109765 491452 491452 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 3 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 3 Fl. Oz. devacurl/devacurlnewpackagingdevagsultradefininggel3oz.jpg 7.75 7.75 5.00 True False False False 5.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

3 Fl. Oz.

SKU 491452

On SaleLog in to view pricing!

Quick View

121175 420110 420110 1 Blow-Dry Spray 1.7 Fl. Oz. Kenra Professional Kenra Professional Kenra Platinum Blow-Dry Spray 1.7 Fl. Oz. kenraprofessional/kenrablowdryspray1.7oz.jpg 8.40 8.40 6.72 True False False False 6.72 False False Diversion contract is required 0 Kenra Professional Platinum Blow-Dry Spray dramatically decreases blow-dry time by up to 50% and provides intense heat protection from damage and breakage up to 428°F. True Log in to view pricing! False

Kenra Professional
Kenra Platinum Blow-Dry Spray

1.7 Fl. Oz.

SKU 420110

On SaleLog in to view pricing!

Quick View

121140 420074 420074 1 Volume Spray 25 55% 1.5 Fl. Oz. Kenra Professional Kenra Professional Volume Spray 25 55% 1.5 Fl. Oz. kenraprofessional/2419380KenraProfessionalVolumeSpray15floz55.jpg 5.25 5.25 4.20 True False False False 4.20 False False Diversion contract is required 0 Kenra Professional Volume Spray 25 55% provides the maximum amount of volume and hold possible. True Log in to view pricing! False

Kenra Professional
Volume Spray 25 55%

1.5 Fl. Oz.

SKU 420074

On SaleLog in to view pricing!

Quick View

80837 485748 485748 1 Root Volumizer N°75 2.4 Fl. Oz. Keune Keune Style Root Volumizer N°75 2.4 Fl. Oz. keune/27429keunestylevolumeno75rootvolumizer75mlonline.jpg 6.25 6.25 5.00 True False False False 5.00 False False Diversion contract is required 0 Build big volume at the roots with Keune's Style Volume Root Volumizer N°75 ultra-lightweight lifting spray. True Log in to view pricing! False

Keune
Style Root Volumizer N°75

2.4 Fl. Oz.

SKU 485748

On SaleLog in to view pricing!

Quick View

20719 119073 119073 1 Moisture Collection Sample Packet LOMA LOMA Moisture Collection Sample Packet noimage.png 2.25 2.25 1.55 True False False False 1.55 False False Diversion contract is required 0 LOMA Moisture Collection Sample Packet. True Log in to view pricing! False

LOMA
Moisture Collection Sample Packet

SKU 119073

On SaleLog in to view pricing!

Quick View

20929 352281 352281 1 DRY TEXTURE SPRAY 1.6 Fl. Oz. MOROCCANOIL MOROCCANOIL DRY TEXTURE SPRAY 1.6 Fl. Oz. moroccanoil/modtexts1oz.jpg 7.50 7.50 6.00 True False False False 6.00 False True Diversion contract is required 0 A dry argan-oil infused texture spray for effortless, undone styles with long-lasting hold. Use MOROCCANOIL DRY TEXTURE SPRAY as a finishing spray for styles with carefree, textured volume. True Log in to view pricing! False

MOROCCANOIL
DRY TEXTURE SPRAY

1.6 Fl. Oz.

SKU 352281

On SaleLog in to view pricing!

Quick View

13783 352285 352285 1 LUMINOUS HAIRSPRAY EXTRA STRONG 2.3 Fl. Oz. MOROCCANOIL MOROCCANOIL LUMINOUS HAIRSPRAY EXTRA STRONG 2.3 Fl. Oz. moroccanoil/moluminhaires.jpg 7.00 7.00 5.60 True False False False 5.60 False True Diversion contract is required 0 MOROCCANOIL LUMINOUS HAIRSPRAY EXTRA STRONG is the ultimate setting hairspray that secures special-event styles: from sleek ponytails to chignons to red-carpet looks. True Log in to view pricing! False

MOROCCANOIL
LUMINOUS HAIRSPRAY EXTRA STRONG

2.3 Fl. Oz.

SKU 352285

On SaleLog in to view pricing!

Quick View

5531 352173 352173 1 LUMINOUS HAIRSPRAY MEDIUM 2.3 Fl. Oz. MOROCCANOIL MOROCCANOIL LUMINOUS HAIRSPRAY MEDIUM 2.3 Fl. Oz. moroccanoil/molumhairmed2oz.jpg 7.00 7.00 5.60 True False False False 5.60 False True Diversion contract is required 0 MOROCCANOIL LUMINOUS HAIRSPRAY MEDIUM is a lightweight and workable hairspray that veils hair in a reflective shield of shine that fights frizz and humidity, yet brushes out easily and leaves no sticky or flaky residue. True Log in to view pricing! False