styling gel

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 15.55 15.55 11.66 True False False False 11.66 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

171889 491500 491500 1 QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 12 Fl. Oz. False devacurl/devacurlquenchn_definegel12oz.jpg Bonus Deal Available 15.55 15.55 11.66 True False False False 11.66 False False Diversion contract is required DevaCurl QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler locks in moisture, enhances shine, provides curl definition, and controls frizz without crunch or flaking! True Log in to view pricing! False

DevaCurl
QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler

12 Fl. Oz.

SKU 491500

On SaleLog in to view pricing!

Quick View

109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 15.55 15.55 11.66 True False False False 11.66 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

121131 420055 420055 1 Styling Gel 17 6 Fl. Oz. Kenra Professional Kenra Professional Styling Gel 17 6 Fl. Oz. False kenraprofessional/2419764KenraProfessionalStylingGel6floz.jpg Bonus Deal Available 10.00 10.00 7.50 True False False False 7.50 False False Diversion contract is required Kenra Professional Styling Gel 17 designed to create versatile looks. True Log in to view pricing! False

Kenra Professional
Styling Gel 17

6 Fl. Oz.

SKU 420055

On SaleLog in to view pricing!

Quick View

154582 499007 499007 1 Hard Up Hard Holding Gel 5.1 Fl. Oz. Sexy Hair Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz. True sexyhair/sexyhairstylehardupgel5.1oz.jpg Bonus Deal Available 10.98 10.98 8.24 True False False False 8.24 False False Diversion contract is required Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a high hold finish and humidity resistance that lasts up to 72 hours. True Log in to view pricing! False

Sexy Hair
Hard Up Hard Holding Gel

On SaleLog in to view pricing!

View Sizes

175008 595710 595710 1 Frozen Gel 5.25 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Style&Care Frozen Gel 5.25 Fl. Oz. False alfaparfmilano/alfaparf25styleandcaresdlfrozengel525oz.jpg Bonus Deal Available 15.75 15.75 15.75 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Style&Care Frozen Gel is an extra-strong hold gel perfect for creating long-lasting ice effect looks. True Log in to view pricing! False

Alfaparf Milano
Semi Di Lino Style&Care Frozen Gel

5.25 Fl. Oz.

SKU 595710

Log in to view pricing!

Quick View

51968 298044 298044 1 curl corps enhancing gel 6.7 Fl. Oz. amika: amika: curl corps enhancing gel 6.7 Fl. Oz. False amika/amikacurlcorpsenhancinggel6oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required amika: curl corps enhancing gel is a weather-proofing, curl-boosting gel that gives bouncy shape without the crunch factor. True Log in to view pricing! False

amika:
curl corps enhancing gel

6.7 Fl. Oz.

SKU 298044

Log in to view pricing!

Quick View

2638 528014 528014 1 Styling Gel 16 Fl. Oz. Clubman Clubman Styling Gel 16 Fl. Oz. False clubman/cl_jar_279200_stygel_hr.jpg Bonus Deal Available 8.00 8.00 8.00 False False False False 0.00 False False Diversion contract is required Specially formulated for me. True Log in to view pricing! False

Clubman
Styling Gel

16 Fl. Oz.

SKU 528014

Log in to view pricing!

Quick View

175338 496004 496004 1 Gel++ 12 Fl. Oz. CURL CLINIC+ CURL CLINIC+ Gel++ 12 Fl. Oz. True curlclinic/curlclinicplusgel12oz.jpg Bonus Deal Available 22.00 22.00 22.00 False False False False 0.00 False False Diversion contract is required CURL CLINIC+ Gel++ delivers long-lasting hold and definition while locking in moisture and protecting curls from frizz. True Log in to view pricing! False

CURL CLINIC+
Gel++

Log in to view pricing!

View Sizes

132746 252922 252922 1 This is a Curl Gel Oil 8.45 Fl. Oz. Davines Davines More Inside This is a Curl Gel Oil 8.45 Fl. Oz. False davines/davinesmoreinsidecurlgeloil8oz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This is a Curl Gel Oil is formulated for extra-curly hair patterns and textures in mind. True Log in to view pricing! False

Davines
More Inside This is a Curl Gel Oil

8.45 Fl. Oz.

SKU 252922

Log in to view pricing!

Quick View

22981 251396 251396 1 This is a Medium Hold Modeling Gel 8.45 Fl. Oz. Davines Davines More Inside This is a Medium Hold Modeling Gel 8.45 Fl. Oz. False davines/davinesmoreinsidemodelinggel845floz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This Is A Medium Hold Modeling Gel gives body an elasticity to curls, dries quickly, and eliminates frizz. True Log in to view pricing! False

Davines
More Inside This is a Medium Hold Modeling Gel

8.45 Fl. Oz.

SKU 251396

Log in to view pricing!

Quick View

20829 251395 251395 1 This is a Strong Hold Cream Gel 4.22 Fl. Oz. Davines Davines More Inside This is a Strong Hold Cream Gel 4.22 Fl. Oz. False davines/davines_moreinside_strong-cream-gel_4.22oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This Is A Strong Hold Cream Gel is quick-drying, residue-free and workable. True Log in to view pricing! False

Davines
More Inside This is a Strong Hold Cream Gel

4.22 Fl. Oz.

SKU 251395

Log in to view pricing!

Quick View

19809 251242 251242 1 Gel 5.07 Fl. Oz. Davines Davines NaturalTech Purifying Gel 5.07 Fl. Oz. False davines/purifyinggel.jpg Bonus Deal Available 20.00 20.00 20.00 False False False False 0.00 False True Diversion contract is required Davines NaturalTech Purifying Gel is an antifungal and antibacterial gel that keeps the scalp clean and healthy. True Log in to view pricing! False

Davines
NaturalTech Purifying Gel

5.07 Fl. Oz.

SKU 251242

Log in to view pricing!

Quick View

166030 889091 889091 1 Firm Hold Gel 4.2 Fl. Oz. eufora eufora FOR HIM Firm Hold Gel 4.2 Fl. Oz. False eufora/euforaforhimfirmholdgel4oz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required eufora FOR HIM Firm Hold Gel is a strong hold styling gel for delivering maximum hold and shine. True Log in to view pricing! False

eufora
FOR HIM Firm Hold Gel

4.2 Fl. Oz.

SKU 889091

Log in to view pricing!

Quick View

171133 988731 988731 1 Define Me Gel 5.1 Fl. Oz. Framesi Framesi FOR-ME Define Me Gel 5.1 Fl. Oz. False framesi/framesiformedefinemegel.jpg Bonus Deal Available 11.05 11.05 11.05 False False False False 0.00 False False Diversion contract is required Framesi FOR-ME Define Me Gel is a versatile styling gel designed for strong, precise hold and defined styling. True Log in to view pricing! False

Framesi
FOR-ME Define Me Gel

5.1 Fl. Oz.

SKU 988731

Log in to view pricing!

Quick View

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

DevaCurl
QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler