Never miss a sale! Sign up for our texts HERE
Home stylinggel
Can't find a Product?

styling gel

CATEGORY GENERIC Single Styling
(40 Items)
  • 109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False
    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    ULTRA DEFINING GEL Strong Hold No-Crunch Styler
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 154582 499007 499007 1 Hard Up Hard Holding Gel 5.1 Fl. Oz. Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz. True sexyhair/sexyhairstylehardupgel5.1oz.jpg Bonus Deal Available 10.98 10.98 8.78 True False False False 8.78 False False Diversion contract is required 0 Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a maximum high hold finish and humidity resistance that lasts up to 48 hours. True Log in to view pricing! False
    Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz.

    Hard Up Hard Holding Gel
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 165955 622001 622001 1 MODE Styling Gel 6.7 Fl. Oz. JOHNNY B. JOHNNY B. MODE Styling Gel 6.7 Fl. Oz. True johnnyb/jbmodestylinggel6oz.jpg Bonus Deal Available 6.50 6.50 5.99 True False False False 5.99 False False Diversion contract is required 0 JOHNNY B. MODE Styling Gel is a high-shine gel that is great for creating wet looks or styles that require a strong hold. True Log in to view pricing! False
    JOHNNY B. MODE Styling Gel 6.7 Fl. Oz.

    JOHNNY B.
    MODE Styling Gel
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 162730 486069 486069 1 HEAD LOCK 6.8 Fl. Oz. Keune Keune Style HEAD LOCK 6.8 Fl. Oz. False keune/keuneheadlock6.8oz.jpg Bonus Deal Available 13.25 13.25 11.93 True False False False 11.93 False False Diversion contract is required 0 Keune's HEAD LOCK is a timeless classic in the range. First conceptualized and meticulously crafted in 1977, this gel has stood the test of time and is all about structure, shine — and amazing hold. True Log in to view pricing! False
    Keune HEAD LOCK 6.8 Fl. Oz.

    Keune
    Style HEAD LOCK

    6.8 Fl. Oz.

    SKU 486069
    Bonus Offer
    On SaleLog in to view pricing!
    Quick View
  • 162727 486060 486060 1 SPRING LOADED 6.8 Fl. Oz. Keune Keune Style SPRING LOADED 6.8 Fl. Oz. False keune/keunespringloaded5.1oz.jpg Bonus Deal Available 13.25 13.25 11.93 True False False False 11.93 False False Diversion contract is required 0 Load, nourish, and define curls with Keune's SPRING LOADED soft gel. True Log in to view pricing! False
    Keune SPRING LOADED 6.8 Fl. Oz.

    Keune
    Style SPRING LOADED

    6.8 Fl. Oz.

    SKU 486060
    Bonus Offer
    On SaleLog in to view pricing!
    Quick View
  • 132443 624467 624467 1 Curl Flex Memory Gel 6.8 Fl. Oz. L'ANZA L'ANZA ADVANCED HEALING CURLS Curl Flex Memory Gel 6.8 Fl. Oz. True lanza/lanzaadvancedhealingcurlscurlflexmemorygel6oz.jpg Bonus Deal Available 15.50 15.50 15.50 False False False False 0.00 False False Diversion contract is required 0 L'ANZA ADVANCED HEALING CURLS Curl Flex Memory Gel gives strong support and hold with maximum curl retention. True Log in to view pricing! False
    L'ANZA Curl Flex Memory Gel 6.8 Fl. Oz.

    L'ANZA
    ADVANCED HEALING CURLS Curl Flex Memory Gel
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 55477 595378 595378 1 Frozen Gel 5.3 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Frozen Gel 5.3 Fl. Oz. False alfaparfmilano/mj18alfaparffrozengel53floz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Frozen Gel is a gel for extreme ice-effect looks. Crystallizes and sets the hair style. A perfect look for 8 hours! True Log in to view pricing! False
    Alfaparf Milano Frozen Gel 5.3 Fl. Oz.

    Alfaparf Milano
    Style Stories Frozen Gel

    5.3 Fl. Oz.

    SKU 595378
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 55471 595376 595376 1 Texturizing Gel 5.07 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Texturizing Gel 5.07 Fl. Oz. False alfaparfmilano/mj18alfaparftexturizinggel507floz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Texturizing Gel brings structure to the hair fiber, for defined and malleable results with a natural effect. Suitable for all hair types, even to enhance natural drying. True Log in to view pricing! False
    Alfaparf Milano Texturizing Gel 5.07 Fl. Oz.

    Alfaparf Milano
    Style Stories Texturizing Gel

    5.07 Fl. Oz.

    SKU 595376
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 143038 795146 795146 1 MY WAY CURL DEFINING GEL 5 Fl. Oz. ALTERNA Professional ALTERNA Professional My Hair My Canvas MY WAY CURL DEFINING GEL 5 Fl. Oz. False alternaprofessional/alternamyhairmycanvasmywaycurldefininggel5oz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required 0 ALTERNA Professional My Hair My Canvas MY WAY CURL DEFINING GEL is a vegan and silicone-free curl defining gel that is non-greasy and non-flaking, providing a soft but flexible hold, and humidity resistance for up to 72-hours. True Log in to view pricing! False
    ALTERNA Professional MY WAY CURL DEFINING GEL 5 Fl. Oz.

    ALTERNA Professional
    My Hair My Canvas MY WAY CURL DEFINING GEL

    5 Fl. Oz.

    SKU 795146
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 51968 298044 298044 1 curl corps enhancing gel 6.7 Fl. Oz. amika: amika: curl corps enhancing gel 6.7 Fl. Oz. False amika/amikacurlcorpsenhancinggel6oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 amika: curl corps enhancing gel is a weather-proofing, curl-boosting gel that gives bouncy shape without the crunch factor. True Log in to view pricing! False
    amika: curl corps enhancing gel 6.7 Fl. Oz.

    amika:
    curl corps enhancing gel

    6.7 Fl. Oz.

    SKU 298044
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 154595 499010 499010 1 Blow Dry Volumizing Gel 8.5 Fl. Oz. Sexy Hair Blow Dry Volumizing Gel 8.5 Fl. Oz. False sexyhair/sexyhairbigblowdryvolumizing8.5oz.jpg Bonus Deal Available 10.98 10.98 10.98 False False False False 0.00 False False Diversion contract is required 0 Sexy Hair Big Sexy Blow Dry Volumizing Gel creates volume and lift with a workable, medium hold and style memory that lasts up to 48 hours. True Log in to view pricing! False
    Sexy Hair Blow Dry Volumizing Gel 8.5 Fl. Oz.

    Blow Dry Volumizing Gel

    8.5 Fl. Oz.

    SKU 499010
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 565 988334 988334 1 Hydro Gel Light 5.1 Fl. Oz. Framesi BY framesi™ Hydro Gel Light 5.1 Fl. Oz. False framesi/738884262312.jpg Bonus Deal Available 7.73 7.73 7.73 False False False False 0.00 False False Diversion contract is required 0 A styling and sculpting gel that creates natural, flexible hold while adding volume and shine. Will not build up and lets your color shine through. True Log in to view pricing! False
    Framesi Hydro Gel Light 5.1 Fl. Oz.

    BY framesi™ Hydro Gel Light

    5.1 Fl. Oz.

    SKU 988334
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 566 988335 988335 1 Hydro Gel Strong 5.1 Fl. Oz. Framesi BY framesi™ Hydro Gel Strong 5.1 Fl. Oz. False framesi/738884262329.jpg Bonus Deal Available 7.73 7.73 7.73 False False False False 0.00 False False Diversion contract is required 0 A strong hold gel that fortifies hair, leaving no residue. Volumizes and enhances shine, lets your color shine through. True Log in to view pricing! False
    Framesi Hydro Gel Strong 5.1 Fl. Oz.

    BY framesi™ Hydro Gel Strong

    5.1 Fl. Oz.

    SKU 988335
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 132746 252922 252922 1 This is a Curl Gel Oil 8.45 Fl. Oz. Davines Davines More Inside This is a Curl Gel Oil 8.45 Fl. Oz. False davines/davinesmoreinsidecurlgeloil8oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False True Diversion contract is required 0 Davines More Inside This is a Curl Gel Oil is formulated for extra-curly hair patterns and textures in mind.  True Log in to view pricing! False
    Davines This is a Curl Gel Oil 8.45 Fl. Oz.

    Davines
    More Inside This is a Curl Gel Oil

    8.45 Fl. Oz.

    SKU 252922
    Bonus Offer
    Log in to view pricing!
    Quick View
(40 Items)