6 brands, one stage – runway is back! Get tickets to the color event of the year
Home hair careshampoorepair damage
Can't find a Product?

hair care shampoo

CATEGORY GENERIC Single Hair Care
(66 Items)
  • 65391 595278 595278 1 Reparative Low Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/am_sdl-reconstruction-reparative-low-shampoo-8-45_oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo is a gentle restructuring shampoo for damaged hair. True Log in to view pricing! False
    Alfaparf Milano Reparative Low Shampoo 8.45 Fl. Oz.

    Alfaparf Milano
    Semi Di Lino Reconstruction Reparative Low Shampoo
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 152989 420173 420173 1 Triple Repair Shampoo 10.1 Fl. Oz. Kenra Professional Kenra Professional Triple Repair Shampoo 10.1 Fl. Oz. True kenraprofessional/kenratriplerepairshampoo10.1.jpg Bonus Deal Available 13.70 13.70 10.28 True False False False 10.28 False False Diversion contract is required Kenra Professional Triple Repair Shampoo is formulated with protective peptides & amino acids to target and repair broken bonds where needed. True Log in to view pricing! False
    Kenra Professional Triple Repair Shampoo 10.1 Fl. Oz.

    Kenra Professional
    Triple Repair Shampoo
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 37955 485572 485572 1 Tinta Color Shampoo 10.1 Fl. Oz. Keune Keune Care Tinta Color Shampoo 10.1 Fl. Oz. True keune/tintashamp10oz.png Bonus Deal Available 14.80 14.80 14.80 False False False False 0.00 False False Diversion contract is required Keune Tinta Color Shampoo repairs and nourishes damaged hair and shields from UV damage and color fading for long-lasting hair color. True Log in to view pricing! False
    Keune Tinta Color Shampoo 10.1 Fl. Oz.

    Keune
    Care Tinta Color Shampoo
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 49034 624129 624129 1 Shampoo 10.1 Fl. Oz. L'ANZA L'ANZA KERATIN HEALING OIL Shampoo 10.1 Fl. Oz. True lanza/keratinshampoo300.jpg Bonus Deal Available 22.25 22.25 16.69 True False False False 16.69 False False Diversion contract is required Keratin Healing Oil Shampoo replenishes vital Keratin Protein to restore hair’s volume, strength and health. True Log in to view pricing! False
    L'ANZA Shampoo 10.1 Fl. Oz.

    L'ANZA
    KERATIN HEALING OIL Shampoo
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 70963 119017 119017 1 Nourishing Shampoo 12 Fl. Oz. LOMA LOMA Nourishing Shampoo 12 Fl. Oz. True loma/lomanourishingshampoo8oz.jpg Bonus Deal Available 11.50 11.50 11.50 False False False False 0.00 False False Diversion contract is required LOMA Nourishing Shampoo contains certified organic ingredients specifically selected to enhance, protect, restore and repair the hair's natural moisture balance while providing vibrant shine. True Log in to view pricing! False
    LOMA Nourishing Shampoo 12 Fl. Oz.

    LOMA
    Nourishing Shampoo
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 137690 595265 595265 1 Deep Cleansing Shampoo 16.9 Fl. Oz. Alfaparf Milano Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo 16.9 Fl. Oz. False alfaparfmilano/alfaparfmilanoktlddeepcleansingshampoo16oz.jpg Bonus Deal Available 22.50 22.50 22.50 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo washes thoroughly and untangles hair perfectly. True Log in to view pricing! False
    Alfaparf Milano Deep Cleansing Shampoo 16.9 Fl. Oz.

    Alfaparf Milano
    Lisse Design Keratin Therapy Deep Cleansing Shampoo

    16.9 Fl. Oz.

    SKU 595265
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 89166 595318 595318 1 Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. False alfaparfmilano/alfaparfsdlscalprenewenergyshampoo8.45oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo gently strengthens, re-densifies and stimulates the hair follicles so that both the scalp and hair fibers can regain balance, strength and body. True Log in to view pricing! False
    Alfaparf Milano Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz.

    Alfaparf Milano
    Semi Di Lino Scalp Renew Energizing Low Shampoo

    8.45 Fl. Oz.

    SKU 595318
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 27504 641525 641525 1 Reparative Shampoo 10.1 Fl. Oz. Aloxxi Aloxxi Reparative Shampoo 10.1 Fl. Oz. True aloxxi/repair-shampoo-retail.jpg Bonus Deal Available 13.90 13.90 13.90 False False False False 0.00 False False Diversion contract is required Aloxxi's Reparative Shampoo renews damaged hair and restores hydration without stripping strands of nourishment. True Log in to view pricing! False
    Aloxxi Reparative Shampoo 10.1 Fl. Oz.

    Aloxxi
    Reparative Shampoo
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 33697 795000 795000 1 Shampoo 1.35 Fl. Oz. ALTERNA Professional ALTERNA Professional Caviar Anti-Aging Replenishing MOISTURE Shampoo 1.35 Fl. Oz. True alternaprofessional/alternaprofessionalreplenishingmoistureshampoo1oz.jpg Bonus Deal Available 6.00 6.00 6.00 False False False False 0.00 False False Diversion contract is required ALTERNA Professional Caviar Anti-Aging Replenishing MOISTURE Shampoo helps to restore and rebalance moisture to hair for noticeably softer, smoother, shinier hair that feels transformed after one use. True Log in to view pricing! False
    ALTERNA Professional Shampoo 1.35 Fl. Oz.

    ALTERNA Professional
    Caviar Anti-Aging Replenishing MOISTURE Shampoo
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 90584 795027 795027 1 Shampoo 1.35 Fl. Oz. ALTERNA Professional ALTERNA Professional Caviar Anti-Aging Restructuring BOND REPAIR Shampoo 1.35 Fl. Oz. True alternaprofessional/alternacaviarbondrepshampoo135oz.jpg Bonus Deal Available 6.50 6.50 6.50 False False False False 0.00 False False Diversion contract is required ALTERNA Professional Caviar Anti-Aging Restructuring BOND REPAIR Shampoo gently yet effectively cleanses hair, removing product buildup, excess oil and impurities while helping to reinforce the hair surface for a renewed feel and look. True Log in to view pricing! False
    ALTERNA Professional Shampoo 1.35 Fl. Oz.

    ALTERNA Professional
    Caviar Anti-Aging Restructuring BOND REPAIR Shampoo
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 133659 298180 298180 1 hydro rush intense moisture shampoo 9.2 Fl. Oz. amika: amika: hydro rush intense moisture shampoo 9.2 Fl. Oz. True amika/amikahydrorushintensemoistureshampoo9oz.jpg Bonus Deal Available 16.25 16.25 16.25 False False False False 0.00 False False Diversion contract is required drench your hair with 3x more hydration* with amika:hydro rush intense moisture shampoo. immersed in potent + natural ingredients, this shampoo gently cleanses while resulting in long-lasting moisture. True Log in to view pricing! False
    amika: hydro rush intense moisture shampoo 9.2 Fl. Oz.

    amika:
    hydro rush intense moisture shampoo
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 144946 298200 298200 1 mirrorball high shine shampoo 9.2 Fl. Oz. amika: amika: mirrorball high shine shampoo 9.2 Fl. Oz. True amika/amikamirrorballhighshineshampoo9oz.jpg Bonus Deal Available 16.25 16.25 16.25 False False False False 0.00 False False Diversion contract is required amika: mirrorball high shine shampoo get shiny hair from every angle. True Log in to view pricing! False
    amika: mirrorball high shine shampoo 9.2 Fl. Oz.

    amika:
    mirrorball high shine shampoo
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 135480 298133 298133 1 the kure strength repair shampoo 9.2 Fl. Oz. amika: amika: the kure strength repair shampoo 9.2 Fl. Oz. True amika/amikathekurestrengthrepairshampoo9.2floz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required amika: the kure strength repair shampoo is a strength repair shampoo that luxuriously lathers and is clinically proven to repair and strengthen damaged strands due to everyday stressors, heat + chemical treatments. True Log in to view pricing! False
    amika: the kure strength repair shampoo 9.2 Fl. Oz.

    amika:
    the kure strength repair shampoo
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 74944 852157 852157 1 Extension Repair Intro B3 BRAZILIAN BOND BUILD3R B3 BRAZILIAN BOND BUILD3R Extension Repair Intro False brazilianprofessionals/b3extensionrepairintro.jpg Bonus Deal Available 149.00 149.00 149.00 False False False False 0.00 False False Diversion contract is required Brazilian b3 Extension Repair Intro includes cleanser, shampoo, conditioner, refresh and capes. True Log in to view pricing! False
    B3 BRAZILIAN BOND BUILD3R Extension Repair Intro

    B3 BRAZILIAN BOND BUILD3R
    Extension Repair Intro

    SKU 852157
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 75020 852161 852161 1 Extension Repair Shampoo 12 Fl. Oz. B3 BRAZILIAN BOND BUILD3R B3 BRAZILIAN BOND BUILD3R Extension Repair Shampoo 12 Fl. Oz. False brazilianprofessionals/b3eshampoo12oz.jpg Bonus Deal Available 16.69 16.69 16.69 False False False False 0.00 False False Diversion contract is required Brazilian b3 Extension Repair Shampoo cleanses and repairs, reinforces fiber strength, prolongs extension life and won't loosen bonds or adhesions. True Log in to view pricing! False
    B3 BRAZILIAN BOND BUILD3R Extension Repair Shampoo 12 Fl. Oz.

    B3 BRAZILIAN BOND BUILD3R
    Extension Repair Shampoo

    12 Fl. Oz.

    SKU 852161
    Bonus Offer
    Log in to view pricing!
    Quick View
(66 Items)