hair care shampoo

105783 298131P 298131P 1 repair salon launch 14 pc. amika: amika: repair salon launch 14 pc. False amika/amikarepairsalonlaunch.jpg Bonus Deal Available 151.50 151.50 151.50 False True False False 0.00 False False Diversion contract is required 0 amika: repair salon launch features several products from the repair line. True Log in to view pricing! False

amika:
repair salon launch

14 pc.

SKU 298131P

Promotional ItemLog in to view pricing!

Quick View

133659 298180 298180 1 hydro rush intense moisture shampoo 9.2 Fl. Oz. amika: amika: hydro rush intense moisture shampoo 9.2 Fl. Oz. True amika/amikahydrorushintensemoistureshampoo9oz.jpg Bonus Deal Available 15.00 15.00 12.75 True False False False 12.75 False False Diversion contract is required 0 drench your hair with 3x more hydration* with amika:hydro rush intense moisture shampoo. immersed in potent + natural ingredients, this shampoo gently cleanses while resulting in long-lasting moisture. True Log in to view pricing! False

amika:
hydro rush intense moisture shampoo

On SaleLog in to view pricing!

View Sizes

135480 298133 298133 1 the kure strength repair shampoo 9.2 Fl. Oz. amika: amika: the kure strength repair shampoo 9.2 Fl. Oz. True amika/amikathekurestrengthrepairshampoo9.2floz.jpg Bonus Deal Available 16.25 16.25 13.81 True False False False 13.81 False False Diversion contract is required 0 amika: the kure strength repair shampoo is a strength repair shampoo that luxuriously lathers and is clinically proven to repair and strengthen damaged strands due to everyday stressors, heat + chemical treatments. True Log in to view pricing! False

amika:
the kure strength repair shampoo

On SaleLog in to view pricing!

View Sizes

109473 491443 491443 1 CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. True devacurl/devagscurlbondcleanser12oz.jpg Bonus Deal Available 18.90 18.90 14.18 True False False False 14.18 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False

DevaCurl
CURLBOND Re-Coiling Mild Lather Cleanser

On SaleLog in to view pricing!

View Sizes

151637 183409 183409 1 Strengthen Shampoo 10.1 Fl. Oz. Joico Joico InnerJoi Strengthen Shampoo 10.1 Fl. Oz. True joico/joicoinnerjoistrengthenshampoo10.1oz.jpg Bonus Deal Available 16.10 16.10 12.07 True False False False 12.07 False False Diversion contract is required 0 Joico’s InnerJoi Strengthen Shampoo is a strengthening cleanser that creates a rich-yet-gentle lather that envelops tired strands with positive reinforcement. True Log in to view pricing! False

Joico
InnerJoi Strengthen Shampoo

On SaleLog in to view pricing!

View Sizes

49034 624129 624129 1 Shampoo 10.1 Fl. Oz. L'ANZA L'ANZA KERATIN HEALING OIL Shampoo 10.1 Fl. Oz. True lanza/keratinshampoo300.jpg Bonus Deal Available 22.25 22.25 16.69 True False False False 16.69 False False Diversion contract is required 0 Keratin Healing Oil Shampoo replenishes vital Keratin Protein to restore hair’s volume, strength and health. True Log in to view pricing! False

L'ANZA
KERATIN HEALING OIL Shampoo

On SaleLog in to view pricing!

View Sizes

137690 595265 595265 1 Deep Cleansing Shampoo 16.9 Fl. Oz. Alfaparf Milano Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo 16.9 Fl. Oz. False alfaparfmilano/alfaparfmilanoktlddeepcleansingshampoo16oz.jpg Bonus Deal Available 22.50 22.50 22.50 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo washes thoroughly and untangles hair perfectly. True Log in to view pricing! False

Alfaparf Milano
Lisse Design Keratin Therapy Deep Cleansing Shampoo

16.9 Fl. Oz.

SKU 595265

Log in to view pricing!

Quick View

65391 595278 595278 1 Reparative Low Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/am_sdl-reconstruction-reparative-low-shampoo-8-45_oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo is a gentle restructuring shampoo for damaged hair. True Log in to view pricing! False

Alfaparf Milano Reparative Low Shampoo 8.45 Fl. Oz.

Alfaparf Milano
Semi Di Lino Reconstruction Reparative Low Shampoo

Log in to view pricing!

View Sizes

89166 595318 595318 1 Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. False alfaparfmilano/alfaparfsdlscalprenewenergyshampoo8.45oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo gently strengthens, re-densifies and stimulates the hair follicles so that both the scalp and hair fibers can regain balance, strength and body. True Log in to view pricing! False

Alfaparf Milano
Semi Di Lino Scalp Renew Energizing Low Shampoo

8.45 Fl. Oz.

SKU 595318

Log in to view pricing!

Quick View

27504 641525 641525 1 Reparative Shampoo 10.1 Fl. Oz. Aloxxi Aloxxi Reparative Shampoo 10.1 Fl. Oz. True aloxxi/repair-shampoo-retail.jpg Bonus Deal Available 13.90 13.90 13.90 False False False False 0.00 False False Diversion contract is required 0 Aloxxi's Reparative Shampoo renews damaged hair and restores hydration without stripping strands of nourishment. True Log in to view pricing! False

Aloxxi
Reparative Shampoo

Log in to view pricing!

View Sizes

100851 795129 795129 1 DENSIFYING Shampoo Liter ALTERNA Professional ALTERNA Professional Caviar Anti-Aging DENSIFYING Shampoo Liter False alternaprofessional/alternacaviardensifyingshampooliter.jpg Bonus Deal Available 39.00 39.00 39.00 False False False False 0.00 False False Diversion contract is required 0 ALTERNA Professional Caviar Anti-Aging Clinical DENSIFYING Shampoo is a gentle cleansing treatment formulated with a soothing texture to cleanse the scalp, eliminate impurities and build-up, and give the appearance of fuller, thicker hair. True Log in to view pricing! False

ALTERNA Professional
Caviar Anti-Aging DENSIFYING Shampoo

Liter

SKU 795129

Log in to view pricing!

Quick View

33703 795001 795001 1 Shampoo 8.5 Fl. Oz. ALTERNA Professional ALTERNA Professional Caviar Anti-Aging Replenishing MOISTURE Shampoo 8.5 Fl. Oz. True alternaprofessional/alternaprofessionalreplenishingmoistureshampoo8oz.jpg Bonus Deal Available 18.00 18.00 18.00 False False False False 0.00 False False Diversion contract is required 0 ALTERNA Professional Caviar Anti-Aging Replenishing MOISTURE Shampoo helps to restore and rebalance moisture to hair for noticeably softer, smoother, shinier hair that feels transformed after one use. True Log in to view pricing! False

ALTERNA Professional Shampoo 8.5 Fl. Oz.

ALTERNA Professional
Caviar Anti-Aging Replenishing MOISTURE Shampoo

Log in to view pricing!

View Sizes

65619 795028 795028 1 Shampoo 8.5 Fl. Oz. ALTERNA Professional ALTERNA Professional Caviar Anti-Aging Restructuring BOND REPAIR Shampoo 8.5 Fl. Oz. True alternaprofessional/alternaprofessionalcaviarantiagingrestructuringbondrepaidshampoo8oz.jpg Bonus Deal Available 18.00 18.00 18.00 False False False False 0.00 False False Diversion contract is required 0 ALTERNA Professional Caviar Anti-Aging Restructuring BOND REPAIR Shampoo gently yet effectively cleanses hair, removing product buildup, excess oil and impurities while helping to reinforce the hair surface for a renewed feel and look. True Log in to view pricing! False

ALTERNA Professional
Caviar Anti-Aging Restructuring BOND REPAIR Shampoo

Log in to view pricing!

View Sizes

74944 852157 852157 1 Extension Repair Intro 15 pc. B3 BRAZILIAN BOND BUILD3R B3 BRAZILIAN BOND BUILD3R Extension Repair Intro 15 pc. False brazilianprofessionals/b3extensionrepairintro.jpg Bonus Deal Available 149.00 149.00 149.00 False False False False 0.00 False False Diversion contract is required 0 Brazilian b3 Extension Repair Intro includes cleanser, shampoo, conditioner, refresh and capes. True Log in to view pricing! False

B3 BRAZILIAN BOND BUILD3R
Extension Repair Intro

15 pc.

SKU 852157

Log in to view pricing!

Quick View

75020 852161 852161 1 Extension Repair Shampoo 12 Fl. Oz. B3 BRAZILIAN BOND BUILD3R B3 BRAZILIAN BOND BUILD3R Extension Repair Shampoo 12 Fl. Oz. False brazilianprofessionals/b3eshampoo12oz.jpg Bonus Deal Available 16.69 16.69 16.69 False False False False 0.00 False False Diversion contract is required 0 Brazilian b3 Extension Repair Shampoo cleanses and repairs, reinforces fiber strength, prolongs extension life and won't loosen bonds or adhesions. True Log in to view pricing! False

B3 BRAZILIAN BOND BUILD3R
Extension Repair Shampoo

12 Fl. Oz.

SKU 852161

Log in to view pricing!

Quick View